PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.009G093700.1
Common NameB456_009G093700, LOC105769526
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 311aa    MW: 34693.9 Da    PI: 9.469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.009G093700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding231.8e-072873346
                        SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                        +WT  E + + +a + + ++   +W ++a++++ g+t  +++  ++ 
  Gorai.009G093700.1 28 KWTSAENKMFENALAVYDKDtpdRWQKVAEMIP-GKTVGDVIKQYRE 73
                        8********************************.******9999986 PP

2Myb_DNA-binding48.12.6e-15135179347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  Gorai.009G093700.1 135 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVVTRTPTQVASHAQKY 179
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.1E-42273IPR009057Homeodomain-like
PROSITE profilePS512938.5512479IPR017884SANT domain
SMARTSM007175.6E-92577IPR001005SANT/Myb domain
SuperFamilySSF466893.82E-112782IPR009057Homeodomain-like
CDDcd001676.28E-72874No hitNo description
PfamPF002495.0E-62873IPR001005SANT/Myb domain
PROSITE profilePS5129421.817128184IPR017930Myb domain
SuperFamilySSF466897.18E-17130183IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-18131183IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.2E-13132179IPR009057Homeodomain-like
SMARTSM007172.7E-13132182IPR001005SANT/Myb domain
CDDcd001671.71E-11135180No hitNo description
PfamPF002495.5E-13135179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MKWEMEILSP ASYLSSTNWF GEESKSTKWT SAENKMFENA LAVYDKDTPD RWQKVAEMIP  60
GKTVGDVIKQ YRELEADVSS IEAGLVPIPG YSTSPFTLDW VNSNGYDGLK QSYGLGGKRS  120
SSGRAADHER KKGVPWTEEE HKLFLMGLKK YGKGDWRNIS RNFVVTRTPT QVASHAQKYF  180
IRQLSGGKDK RRASIHDITT VNLNDMRTPS PDNKGTPSPE QSSVLTQQPN SAAMPRTHFQ  240
WNPPCGGATM AFNSTQGSML MSSPYGVPSY GLKMQGQSLQ RSAAHESYFG PQNLVFQMQS  300
AEQYPQNHLF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1629941176RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445667.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-148DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D2TGI10.0A0A0D2TGI1_G
STRINGPOPTR_0001s25590.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-110MYB family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]